PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g081390.1
Common NameMTR_3g081390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 127aa    MW: 14363.4 Da    PI: 7.1104
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g081390.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.81.7e-105395346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      W+  E++ll++a  ++G  +W+ +a+++g ++++  c+ ++++
  Medtr3g081390.1 53 DWSVHEELLLLEALDMYGFANWNGVAEHVG-TKSESRCIGHYND 95
                     5*****************************.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.23E-114798IPR009057Homeodomain-like
PROSITE profilePS5129316.03149101IPR017884SANT domain
SMARTSM007173.6E-75099IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-65395IPR009057Homeodomain-like
PfamPF002491.8E-105395IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MGHKNRSKKK RAALNAEGLE TSICRFGSLH RLLFCNHSYR VMDDLSFPLT CPDWSVHEEL  60
LLLEALDMYG FANWNGVAEH VGTKSESRCI GHYNDVYLNL PSFPLPDLSY SMRKNKEELI  120
AMAKGD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013461147.13e-91myb-like DNA-binding domain protein
SwissprotQ9ATB42e-37TAD2B_ARATH; Transcriptional adapter ADA2b
TrEMBLA0A072V0E73e-91A0A072V0E7_MEDTR; Myb-like DNA-binding domain protein
STRINGGLYMA13G11200.21e-39(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]